Lineage for d1sema_ (1sem A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392660Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 2392661Species Caenorhabditis elegans, SEM-5 [TaxId:6239] [50073] (5 PDB entries)
    Sex muscle abnormal protein 5
  8. 2392662Domain d1sema_: 1sem A: [24544]
    C-terminal domain

Details for d1sema_

PDB Entry: 1sem (more details), 2 Å

PDB Description: structural determinants of peptide-binding orientation and of sequence specificity in sh3 domains
PDB Compounds: (A:) sem-5

SCOPe Domain Sequences for d1sema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]}
etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpyn

SCOPe Domain Coordinates for d1sema_:

Click to download the PDB-style file with coordinates for d1sema_.
(The format of our PDB-style files is described here.)

Timeline for d1sema_:

2392662
d1sema_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1semb_