Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (16 families) |
Family c.47.1.1: Thioltransferase [52834] (13 proteins) |
Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (1 species) |
Species Escherichia coli [TaxId:562] [102436] (2 PDB entries) |
Domain d1se1a2: 1se1 A:428-545 [98816] Other proteins in same PDB: d1se1a1, d1se1b1, d1se1c1 |
PDB Entry: 1se1 (more details), 2.85 Å
SCOP Domain Sequences for d1se1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1se1a2 c.47.1.1 (A:428-545) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli} hlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvqkaladtvll qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrq
Timeline for d1se1a2:
View in 3D Domains from other chains: (mouse over for more information) d1se1b1, d1se1b2, d1se1c1, d1se1c2 |