Lineage for d1sbpa_ (1sbp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914663Protein Sulphate-binding protein [53858] (1 species)
  7. 2914664Species Salmonella typhimurium [TaxId:90371] [53859] (1 PDB entry)
  8. 2914665Domain d1sbpa_: 1sbp A: [35760]
    complexed with so4
    has additional insertions and/or extensions that are not grouped together

Details for d1sbpa_

PDB Entry: 1sbp (more details), 1.7 Å

PDB Description: 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding
PDB Compounds: (A:) sulfate-binding protein

SCOPe Domain Sequences for d1sbpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbpa_ c.94.1.1 (A:) Sulphate-binding protein {Salmonella typhimurium [TaxId: 90371]}
kdiqllnvsydptrelyeqynkafsahwkqetgdnvvidqshggsgkqatsvingieadt
vtlalaydvnaiaergridknwikrlpddsapytstivflvrkgnpkqihdwndlikpgv
svitpnpkssggarwnylaawgyalhhnnndqakaedfvkalfknvevldsgargstntf
vergigdvliaweneallatnelgkdkfeivtpsesilaeptvsvvdkvvekkdtkavae
aylkylyspegqeiaaknfyrprdadvakkyddafpklklftidevfggwakaqkdhfad
ggtfdqisk

SCOPe Domain Coordinates for d1sbpa_:

Click to download the PDB-style file with coordinates for d1sbpa_.
(The format of our PDB-style files is described here.)

Timeline for d1sbpa_: