![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
![]() | Protein Copper chaperone [55017] (3 species) |
![]() | Species Synechocystis sp. PCC 6803, Scatx1 [TaxId:1148] [102998] (5 PDB entries) |
![]() | Domain d1sb6a_: 1sb6 A: [98790] |
PDB Entry: 1sb6 (more details)
SCOPe Domain Sequences for d1sb6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. PCC 6803, Scatx1 [TaxId: 1148]} mtiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasag heve
Timeline for d1sb6a_: