Lineage for d1sb6a_ (1sb6 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029142Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1029143Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 1029176Protein Copper chaperone [55017] (3 species)
  7. 1029182Species Synechocystis sp. PCC 6803, Scatx1 [TaxId:1148] [102998] (5 PDB entries)
  8. 1029191Domain d1sb6a_: 1sb6 A: [98790]

Details for d1sb6a_

PDB Entry: 1sb6 (more details)

PDB Description: Solution structure of a cyanobacterial copper metallochaperone, ScAtx1
PDB Compounds: (A:) copper chaperone ScAtx1

SCOPe Domain Sequences for d1sb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. PCC 6803, Scatx1 [TaxId: 1148]}
mtiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasag
heve

SCOPe Domain Coordinates for d1sb6a_:

Click to download the PDB-style file with coordinates for d1sb6a_.
(The format of our PDB-style files is described here.)

Timeline for d1sb6a_: