Lineage for d1saza1 (1saz A:1-172)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492018Family c.55.1.2: Acetokinase-like [53080] (4 proteins)
  6. 2492033Protein butyrate kinase 2 [142460] (1 species)
  7. 2492034Species Thermotoga maritima [TaxId:2336] [142461] (2 PDB entries)
    Uniprot Q9X278 1-172! Uniprot Q9X278 173-375
  8. 2492035Domain d1saza1: 1saz A:1-172 [118925]
    complexed with acp, fmt, na

Details for d1saza1

PDB Entry: 1saz (more details), 2.5 Å

PDB Description: Membership in the ASKHA Superfamily: Enzymological Properties and Crystal Structure of Butyrate Kinase 2 from Thermotoga maritima
PDB Compounds: (A:) Probable butyrate kinase 2

SCOPe Domain Sequences for d1saza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1saza1 c.55.1.2 (A:1-172) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]}
mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkr

SCOPe Domain Coordinates for d1saza1:

Click to download the PDB-style file with coordinates for d1saza1.
(The format of our PDB-style files is described here.)

Timeline for d1saza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1saza2