Lineage for d1sa3a_ (1sa3 A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the restSuperfamily c.52.1: Restriction endonuclease-like [52980] (33 families) 
Family c.52.1.23: Restriction endonuclease MspI [110624] (1 protein) Protein Restriction endonuclease MspI [110625] (1 species) Species Moraxella sp. [TaxId:479] [110626] (2 PDB entries)
Uniprot P11405
Domain d1sa3a_: 1sa3 A: [105400]
Details for d1sa3a_
PDB Entry: 1sa3 (more details), 1.95 Å
PDB Description: an asymmetric complex of restriction endonuclease mspi on its palindromic dna recognition site
PDB Compounds: (A:) Type II restriction enzyme MspISCOP Domain Sequences for d1sa3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sa3a_ c.52.1.23 (A:) Restriction endonuclease MspI {Moraxella sp. [TaxId: 479]}
mrtellsklyddfgidqlphtqhgvtsdrlgklyekyildifkdieslkkyntnafpqek
disskllkalnldldniidvsssdtdlgrtiaggspktdatirftfhnqssrlvplnikh
sskkkvsiaeydvetictgvgisdgelkelirkhqndqsaklftpvqkqrltellepyre
rfirwcvtlraeksegnilhpdllirfqvidreyvdvtikniddyvsdriaegskarkpg
fgtglnwtyasgskakkmqfkg
SCOP Domain Coordinates for d1sa3a_:
Click to download the PDB-style file with coordinates for d1sa3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sa3a_:
- d1sa3a_ first appeared in SCOP 1.69
- d1sa3a_ appears in SCOP 1.73
- d1sa3a_ appears in SCOPe 2.01
- d1sa3a_ appears in the current release, SCOPe 2.08
View in 3D
