Lineage for d1sa0b2 (1sa0 B:246-438)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565829Protein Tubulin beta-subunit [55313] (2 species)
  7. 2565830Species Cow (Bos taurus) [TaxId:9913] [64322] (7 PDB entries)
    Uniprot P02554
  8. 2565835Domain d1sa0b2: 1sa0 B:246-438 [98772]
    Other proteins in same PDB: d1sa0a1, d1sa0a2, d1sa0b1, d1sa0c1, d1sa0c2, d1sa0d1, d1sa0e1, d1sa0e2
    complexed with cn2, gdp, gtp, mg

Details for d1sa0b2

PDB Entry: 1sa0 (more details), 3.58 Å

PDB Description: tubulin-colchicine: stathmin-like domain complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d1sa0b2:

Sequence, based on SEQRES records: (download)

>d1sa0b2 d.79.2.1 (B:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d1sa0b2 d.79.2.1 (B:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsltvpeltqqmfdaknmmaacdprhgryl
tvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfigns
taiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda

SCOPe Domain Coordinates for d1sa0b2:

Click to download the PDB-style file with coordinates for d1sa0b2.
(The format of our PDB-style files is described here.)

Timeline for d1sa0b2: