Lineage for d1s96a_ (1s96 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. Protein Guanylate kinase [52542] (5 species)
  7. Species Escherichia coli [TaxId:562] [102338] (6 PDB entries)
  8. Domain d1s96a_: 1s96 A: [98740]
    complexed with po4, unx

Details for d1s96a_

PDB Entry: 1s96 (more details), 2 Å

PDB Description: The 2.0 A X-ray structure of Guanylate Kinase from E.coli
PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d1s96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}
qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
iraerlrmsrqkqrhdaliskllad

SCOPe Domain Coordinates for d1s96a_ are not available.

Timeline for d1s96a_:

Domains from other chains:
(mouse over for more information)
d1s96b_