Lineage for d1s7ja_ (1s7j A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
mixed beta-sheet folds into a barrel (n=8, S=14) around the central helixSuperfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) 
duplication: consists of two similar domain swapped with C-terminal strandsFamily d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
Pfam PF02567
Protein Hypothetical protein EF0119 [102852] (1 species) Species Enterococcus faecalis [TaxId:1351] [102853] (1 PDB entry) 
Domain d1s7ja_: 1s7j A: [98647]
structural genomics
Details for d1s7ja_
PDB Entry: 1s7j (more details), 2.3 Å
PDB Description: crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis)
PDB Compounds: (A:) phenazine biosynthesis protein PhzF familySCOPe Domain Sequences for d1s7ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7ja_ d.21.1.2 (A:) Hypothetical protein EF0119 {Enterococcus faecalis [TaxId: 1351]}
msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
enrviiggtaklfakgeayl
SCOPe Domain Coordinates for d1s7ja_:
Click to download the PDB-style file with coordinates for d1s7ja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s7ja_:
- d1s7ja_ first appeared in SCOP 1.67
- d1s7ja_ appears in SCOPe 2.06
- d1s7ja_ appears in the current release, SCOPe 2.08
View in 3D
