Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins) Pfam PF02567 |
Protein Hypothetical protein EF0119 [102852] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [102853] (1 PDB entry) |
Domain d1s7ja_: 1s7j A: [98647] structural genomics |
PDB Entry: 1s7j (more details), 2.3 Å
SCOPe Domain Sequences for d1s7ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7ja_ d.21.1.2 (A:) Hypothetical protein EF0119 {Enterococcus faecalis [TaxId: 1351]} msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk enrviiggtaklfakgeayl
Timeline for d1s7ja_: