Lineage for d1s6bb_ (1s6b B:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
common core: 2 helices, disulfide-linked, and a calcium-binding loopSuperfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
automatically mapped to Pfam PF00068Protein Snake phospholipase A2 [48624] (38 species) 
Species Andaman cobra (Naja sagittifera), isoform 3 [TaxId:195058] [89170] (4 PDB entries)
heterodimer of two different isoforms
Domain d1s6bb_: 1s6b B: [98593]
heterodimer of two different isoforms
complexed with acy, ca, po4
Details for d1s6bb_
PDB Entry: 1s6b (more details), 1.6 Å
PDB Description: x-ray crystal structure of a complex formed between two homologous isoforms of phospholipase a2 from naja naja sagittifera: principle of molecular association and inactivation
PDB Compounds: (B:) Phospholipase A2 isoform 2SCOPe Domain Sequences for d1s6bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s6bb_ a.133.1.2 (B:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 3 [TaxId: 195058]}
nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarcn
SCOPe Domain Coordinates for d1s6bb_:
Click to download the PDB-style file with coordinates for d1s6bb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s6bb_:
- d1s6bb_ first appeared in SCOP 1.67
- d1s6bb_ appears in SCOPe 2.05
- d1s6bb_ appears in SCOPe 2.07
- d1s6bb_ appears in the current release, SCOPe 2.08
View in 3D
