Lineage for d1s5xa_ (1s5x A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1254022Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1254091Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (11 PDB entries)
  8. 1254102Domain d1s5xa_: 1s5x A: [98585]
    Other proteins in same PDB: d1s5xb_
    complexed with hem

Details for d1s5xa_

PDB Entry: 1s5x (more details), 2.4 Å

PDB Description: The crystal structure of Trematomus bernacchii hemoglobin oxidized by air
PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d1s5xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5xa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d1s5xa_:

Click to download the PDB-style file with coordinates for d1s5xa_.
(The format of our PDB-style files is described here.)

Timeline for d1s5xa_: