Lineage for d1s5xa_ (1s5x A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.2: Globins [46463] (27 proteins)
Heme-binding protein
Protein Hemoglobin, alpha-chain [46486] (24 species) 
Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (12 PDB entries) 
Domain d1s5xa_: 1s5x A: [98585]
Other proteins in same PDB: d1s5xb_
complexed with hem
Details for d1s5xa_
PDB Entry: 1s5x (more details), 2.4 Å
PDB Description: The crystal structure of Trematomus bernacchii hemoglobin oxidized by air
PDB Compounds: (A:) hemoglobin alpha chainSCOPe Domain Sequences for d1s5xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5xa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr
SCOPe Domain Coordinates for d1s5xa_:
Click to download the PDB-style file with coordinates for d1s5xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s5xa_:
- d1s5xa_ first appeared in SCOP 1.67
- d1s5xa_ appears in SCOPe 2.07
View in 3D
