Lineage for d1s55a_ (1s55 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777375Protein TRANCE/RANKL cytokine [63721] (1 species)
  7. 2777376Species Mouse (Mus musculus) [TaxId:10090] [63722] (6 PDB entries)
  8. 2777377Domain d1s55a_: 1s55 A: [118865]
    automated match to d1iqaa_
    complexed with cl

Details for d1s55a_

PDB Entry: 1s55 (more details), 1.9 Å

PDB Description: Mouse RANKL Structure at 1.9A Resolution
PDB Compounds: (A:) tumor necrosis factor ligand superfamily member 11

SCOPe Domain Sequences for d1s55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s55a_ b.22.1.1 (A:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdid

SCOPe Domain Coordinates for d1s55a_:

Click to download the PDB-style file with coordinates for d1s55a_.
(The format of our PDB-style files is described here.)

Timeline for d1s55a_: