Lineage for d1s4za_ (1s4z A:)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.13: Chromo domain-like [54160] (4 families) 
SH3-like barrel is capped by a C-terminal helix
Family b.34.13.2: Chromo domain [54165] (8 proteins)
lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
Protein Heterochromatin protein 1, HP1 [54166] (4 species)
duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
Species Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId:10090] [54167] (5 PDB entries) 
Domain d1s4za_: 1s4z A: [98515]
Chromo shadow domain complexed with pxvxl motif peptide of caf-1, chain C
Details for d1s4za_
PDB Entry: 1s4z (more details)
PDB Description: hp1 chromo shadow domain in complex with pxvxl motif of caf-1
PDB Compounds: (A:) chromobox protein homolog 1SCOPe Domain Sequences for d1s4za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4za_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]}
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwhsypsd
SCOPe Domain Coordinates for d1s4za_:
Click to download the PDB-style file with coordinates for d1s4za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s4za_:
- d1s4za_ first appeared in SCOP 1.67
- d1s4za_ appears in SCOP 1.75
- d1s4za_ appears in SCOPe 2.02
- d1s4za_ appears in the current release, SCOPe 2.08, called d1s4za1
View in 3D
