Lineage for d1s4za_ (1s4z A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665974Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 665998Family b.34.13.2: Chromo domain [54165] (7 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 666040Protein Heterochromatin protein 1, HP1 [54166] (3 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 666048Species Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId:10090] [54167] (5 PDB entries)
  8. 666056Domain d1s4za_: 1s4z A: [98515]

Details for d1s4za_

PDB Entry: 1s4z (more details)

PDB Description: HP1 chromo shadow domain in complex with PXVXL motif of CAF-1
PDB Compounds: (A:) chromobox protein homolog 1

SCOP Domain Sequences for d1s4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4za_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]}
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwhsypsd

SCOP Domain Coordinates for d1s4za_:

Click to download the PDB-style file with coordinates for d1s4za_.
(The format of our PDB-style files is described here.)

Timeline for d1s4za_: