Lineage for d1s4va_ (1s4v A:)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (23 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheetFamily d.3.1.1: Papain-like [54002] (26 proteins) 
Protein Vignain (bean endopeptidase) [102719] (1 species) Species Castor bean (Ricinus communis) [TaxId:3988] [102720] (1 PDB entry) 
Domain d1s4va_: 1s4v A: [98511]
complexed with so4
Details for d1s4va_
PDB Entry: 1s4v (more details), 2 Å
PDB Description: The 2.0 A crystal structure of the KDEL-tailed cysteine endopeptidase functioning in programmed cell death of Ricinus communis endosperm
PDB Compounds: (A:) cysteine endopeptidaseSCOPe Domain Sequences for d1s4va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]}
tvpasvdwrkkgavtsvkdqgqcgscwafstivaveginqiktnklvslseqelvdcdtd
qnqgcngglmdyafefikqrggitteanypyeaydgtcdvskenapavsidghenvpend
enallkavanqpvsvaidaggsdfqfysegvftgscgteldhgvaivgygttidgtkywt
vknswgpewgekgyirmergisdkeglcgiameasypikkssnn
SCOPe Domain Coordinates for d1s4va_:
Click to download the PDB-style file with coordinates for d1s4va_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s4va_:
- d1s4va_ first appeared in SCOP 1.67
- d1s4va_ appears in SCOP 1.75
- d1s4va_ appears in SCOPe 2.02
- d1s4va_ appears in the current release, SCOPe 2.08
View in 3D
