Lineage for d1s4qa_ (1s4q A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829535Protein Guanylate kinase [52542] (4 species)
  7. 829563Species Mycobacterium tuberculosis [TaxId:1773] [102339] (5 PDB entries)
    Rv1389
  8. 829565Domain d1s4qa_: 1s4q A: [98507]
    complexed with cl, fmt

Details for d1s4qa_

PDB Entry: 1s4q (more details), 2.16 Å

PDB Description: Crystal Structure of Guanylate Kinase from Mycobacterium tuberculosis (Rv1389)
PDB Compounds: (A:) Guanylate kinase

SCOP Domain Sequences for d1s4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4qa_ c.37.1.1 (A:) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq
lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf
lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl
lvg

SCOP Domain Coordinates for d1s4qa_:

Click to download the PDB-style file with coordinates for d1s4qa_.
(The format of our PDB-style files is described here.)

Timeline for d1s4qa_: