Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Guanylate kinase [52542] (4 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [102339] (5 PDB entries) Rv1389 |
Domain d1s4qa_: 1s4q A: [98507] complexed with cl, fmt |
PDB Entry: 1s4q (more details), 2.16 Å
SCOP Domain Sequences for d1s4qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4qa_ c.37.1.1 (A:) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl lvg
Timeline for d1s4qa_: