Lineage for d1s4ma2 (1s4m A:1-158)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) 
Family c.26.1.3: Adenylyltransferase [52397] (5 proteins) 
Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species) Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries)
TM0379
Domain d1s4ma2: 1s4m A:1-158 [112024]
Other proteins in same PDB: d1s4ma1, d1s4mb1
Details for d1s4ma2
PDB Entry: 1s4m (more details), 2.1 Å
PDB Description: crystal structure of flavin binding to fad synthetase from thermotoga maritina
PDB Compounds: (A:) Riboflavin kinase/FMN adenylyltransferaseSCOP Domain Sequences for d1s4ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4ma2 c.26.1.3 (A:1-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
evyeiedvvvqgkrvssslirnlvqegrveeipaylgr
SCOP Domain Coordinates for d1s4ma2:
Click to download the PDB-style file with coordinates for d1s4ma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s4ma2:
- d1s4ma2 first appeared in SCOP 1.71
- d1s4ma2 appears in SCOP 1.75
- d1s4ma2 appears in the current release, SCOPe 2.08
View in 3D
