Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [53071] (7 PDB entries) |
Domain d1s3xa2: 1s3x A:189-382 [98468] complexed with adp, ca, na, po4 |
PDB Entry: 1s3x (more details), 1.84 Å
SCOPe Domain Sequences for d1s3xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3xa2 c.55.1.1 (A:189-382) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]} gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk hkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcsd lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea vaygaavqaailmg
Timeline for d1s3xa2: