Lineage for d1s3la_ (1s3l A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938246Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1938247Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1938484Family d.159.1.7: YfcE-like [111233] (5 proteins)
  6. 1938491Protein Putative phosphodiesterase MJ0936 [111234] (1 species)
  7. 1938492Species Methanococcus jannaschii [TaxId:2190] [111235] (3 PDB entries)
    Uniprot Q58346
  8. 1938493Domain d1s3la_: 1s3l A: [105241]
    Structural genomics target
    complexed with po4, unx

Details for d1s3la_

PDB Entry: 1s3l (more details), 2.4 Å

PDB Description: Structural and Functional Characterization of a Novel Archaeal Phosphodiesterase
PDB Compounds: (A:) Hypothetical protein MJ0936

SCOPe Domain Sequences for d1s3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]}
mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl

SCOPe Domain Coordinates for d1s3la_:

Click to download the PDB-style file with coordinates for d1s3la_.
(The format of our PDB-style files is described here.)

Timeline for d1s3la_: