Lineage for d1s3la_ (1s3l A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplicationSuperfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) 
different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
Family d.159.1.7: YfcE-like [111233] (5 proteins) 
Protein Putative phosphodiesterase MJ0936 [111234] (1 species) Species Methanococcus jannaschii [TaxId:2190] [111235] (3 PDB entries)
Uniprot Q58346
Domain d1s3la_: 1s3l A: [105241]
Structural genomics target
complexed with po4, unx
Details for d1s3la_
PDB Entry: 1s3l (more details), 2.4 Å
PDB Description: Structural and Functional Characterization of a Novel Archaeal Phosphodiesterase
PDB Compounds: (A:) Hypothetical protein MJ0936SCOPe Domain Sequences for d1s3la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]}
mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl
SCOPe Domain Coordinates for d1s3la_:
Click to download the PDB-style file with coordinates for d1s3la_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s3la_:
- d1s3la_ first appeared in SCOP 1.69
- d1s3la_ appears in SCOPe 2.03
- d1s3la_ appears in SCOPe 2.05
- d1s3la_ appears in the current release, SCOPe 2.08
View in 3D
