Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.7: YfcE-like [111233] (5 proteins) |
Protein Putative phosphodiesterase MJ0936 [111234] (1 species) |
Species Methanococcus jannaschii [TaxId:2190] [111235] (3 PDB entries) Uniprot Q58346 |
Domain d1s3la_: 1s3l A: [105241] Structural genomics target complexed with po4, unx |
PDB Entry: 1s3l (more details), 2.4 Å
SCOPe Domain Sequences for d1s3la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl
Timeline for d1s3la_: