Lineage for d1s3ea2 (1s3e A:290-401)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542330Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2542331Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2542545Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 2542598Protein Monoamine oxidase B [69673] (2 species)
  7. 2542599Species Human (Homo sapiens) [TaxId:9606] [69674] (46 PDB entries)
  8. 2542600Domain d1s3ea2: 1s3e A:290-401 [98427]
    Other proteins in same PDB: d1s3ea1, d1s3eb1
    complexed with fad

Details for d1s3ea2

PDB Entry: 1s3e (more details), 1.6 Å

PDB Description: Crystal structure of MAOB in complex with 6-hydroxy-N-propargyl-1(R)-aminoindan
PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d1s3ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3ea2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOPe Domain Coordinates for d1s3ea2:

Click to download the PDB-style file with coordinates for d1s3ea2.
(The format of our PDB-style files is described here.)

Timeline for d1s3ea2:

2542600
d1s3ea2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1s3ea1