Lineage for d1s2ba_ (1s2b A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664307Family b.29.1.20: Peptidase A4 [101656] (2 proteins)
    circular permutation of the canonical fold
  6. 664311Protein Scytalidopepsin B [101657] (1 species)
  7. 664312Species Fungus (Scytalidium lignicola) [TaxId:5539] [101658] (4 PDB entries)
  8. 664314Domain d1s2ba_: 1s2b A: [98375]

Details for d1s2ba_

PDB Entry: 1s2b (more details), 2.1 Å

PDB Description: Structure of SCP-B the first member of the Eqolisin family of Peptidases to have its structure determined
PDB Compounds: (A:) Scytalidopepsin B

SCOP Domain Sequences for d1s2ba_:

Sequence, based on SEQRES records: (download)

>d1s2ba_ b.29.1.20 (A:) Scytalidopepsin B {Fungus (Scytalidium lignicola) [TaxId: 5539]}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
itqviinnqdvtdcsvsgttvscsyv

Sequence, based on observed residues (ATOM records): (download)

>d1s2ba_ b.29.1.20 (A:) Scytalidopepsin B {Fungus (Scytalidium lignicola) [TaxId: 5539]}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewevsitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsnessgslc
rtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaqitqviin
nqdvtdcsvsgttvscsyv

SCOP Domain Coordinates for d1s2ba_:

Click to download the PDB-style file with coordinates for d1s2ba_.
(The format of our PDB-style files is described here.)

Timeline for d1s2ba_: