Lineage for d1s1ij_ (1s1i J:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896327Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111483] (2 PDB entries)
  8. 896355Domain d1s1ij_: 1s1i J: [105184]
    MQ NA # low resolution complex structure
    60S subunit; the 40S subunit is in 1S1H

Details for d1s1ij_

PDB Entry: 1s1i (more details), 11.7 Å

PDB Description: Structure of the ribosomal 80S-eEF2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 A cryo-EM map. This file, 1S1I, Contains 60S subunit. The 40S Ribosomal Subunit Is In File 1S1H.
PDB Compounds: (J:) 60S Ribosomal protein L11

SCOP Domain Sequences for d1s1ij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ij_ i.1.1.1 (J:) 70S ribosome functional complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
npmrdlkieklvlnisvgesgdrltraskvleqlsgqtpvqskarytvrtfgirrnekia
vhvtvrgpkaeeilerglkvkeyqlrdrnfsatgnfgfgidehidlgikydpsigifgmd
fyvvmnrpgarvtrrkrckgtvgnshkttkedtvswfkqkydadv

SCOP Domain Coordinates for d1s1ij_:

Click to download the PDB-style file with coordinates for d1s1ij_.
(The format of our PDB-style files is described here.)

Timeline for d1s1ij_: