Lineage for d1s16a2 (1s16 A:1004-1216)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) 
Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins) 
Protein Topoisomerase IV subunit B [103228] (1 species) Species Escherichia coli [TaxId:562] [103229] (2 PDB entries) 
Domain d1s16a2: 1s16 A:1004-1216 [98332]
Other proteins in same PDB: d1s16a1, d1s16b1
complexed with anp, mg, so4
Details for d1s16a2
PDB Entry: 1s16 (more details), 2.1 Å
PDB Description: Crystal Structure of E. coli Topoisomerase IV ParE 43kDa subunit complexed with ADPNP
PDB Compounds: (A:) Topoisomerase IV subunit BSCOPe Domain Sequences for d1s16a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s16a2 d.122.1.2 (A:1004-1216) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]}
tynadaievltglepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadq
sleviddgrgmpvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvnals
krvevnvrrdgqvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsr
lthvlkakavlcpgveitfkdeinnteqrwcyq
SCOPe Domain Coordinates for d1s16a2:
Click to download the PDB-style file with coordinates for d1s16a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s16a2:
- d1s16a2 first appeared in SCOP 1.67
- d1s16a2 appears in SCOPe 2.02
- d1s16a2 appears in SCOPe 2.04
- d1s16a2 appears in the current release, SCOPe 2.08
View in 3D
