Lineage for d1rzua_ (1rzu A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1007198Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 1007199Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families) (S)
  5. 1007536Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
    Pfam PF00534
  6. 1007540Protein Glycogen synthase 1, GlgA [110735] (2 species)
  7. 1007541Species Agrobacterium tumefaciens [TaxId:358] [110736] (2 PDB entries)
    Uniprot P39670
  8. 1007542Domain d1rzua_: 1rzu A: [105140]
    complexed with adp

Details for d1rzua_

PDB Entry: 1rzu (more details), 2.3 Å

PDB Description: crystal structure of the glycogen synthase from a. tumefaciens in complex with adp
PDB Compounds: (A:) Glycogen synthase 1

SCOPe Domain Sequences for d1rzua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]}
mnvlsvsseiypliktggladvvgalpialeahgvrtrtlipgypavkaavtdpvkcfef
tdllgekadllevqherldllildapayyersggpylgqtgkdypdnwkrfaalslaaar
igagvlpgwrpdmvhahdwqaamtpvymryaetpeipslltihniafqgqfganifskla
lpahafgmegieyyndvsflkgglqtatalstvspsyaeeiltaefgmglegvigsrahv
lhgivngidadvwnpatdhlihdnysaanlknralnkkavaehfridddgsplfcvisrl
twqkgidlmaeavdeivslggrlvvlgagdvalegallaaasrhhgrvgvaigyneplsh
lmqagcdaiiipsrfepcgltqlyalrygcipvvartggladtvidanhaalaskaatgv
qfspvtldglkqairrtvryyhdpklwtqmqklgmksdvsweksaglyaalysqlis

SCOPe Domain Coordinates for d1rzua_:

Click to download the PDB-style file with coordinates for d1rzua_.
(The format of our PDB-style files is described here.)

Timeline for d1rzua_: