Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species) |
Species Thermotoga maritima [TaxId:2336] [110363] (1 PDB entry) Uniprot Q9WYH8 |
Domain d1rzma_: 1rzm A: [105137] complexed with cd, e4p, pep |
PDB Entry: 1rzm (more details), 2.2 Å
SCOPe Domain Sequences for d1rzma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzma_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh pepekalsdgkqsldfelfkelvqemkkladalgvkvn
Timeline for d1rzma_: