Lineage for d1rzma_ (1rzm A:)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.10: Aldolase [51569] (9 families) 
Common fold covers whole protein structure
Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species) 
Species Thermotoga maritima [TaxId:2336] [110363] (1 PDB entry)
Uniprot Q9WYH8
Domain d1rzma_: 1rzm A: [105137]
complexed with cd, e4p, pep
Details for d1rzma_
PDB Entry: 1rzm (more details), 2.2 Å
PDB Description: Crystal structure of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHPS) from Thermotoga maritima complexed with Cd2+, PEP and E4P
PDB Compounds: (A:) phospho-2-dehydro-3-deoxyheptonate aldolaseSCOPe Domain Sequences for d1rzma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzma_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]}
mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve
svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel
gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi
iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir
tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh
pepekalsdgkqsldfelfkelvqemkkladalgvkvn
SCOPe Domain Coordinates for d1rzma_:
Click to download the PDB-style file with coordinates for d1rzma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rzma_:
- d1rzma_ first appeared in SCOP 1.69
- d1rzma_ appears in SCOP 1.75
- d1rzma_ appears in SCOPe 2.02
- d1rzma_ appears in the current release, SCOPe 2.08
View in 3D
