Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries) |
Domain d1rz8a1: 1rz8 A:1-109 [98137] Other proteins in same PDB: d1rz8a2, d1rz8b1, d1rz8b2, d1rz8c2, d1rz8d1, d1rz8d2 part of anti HIV-1 gp120 Fab 17B |
PDB Entry: 1rz8 (more details), 2.3 Å
SCOPe Domain Sequences for d1rz8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rz8a1 b.1.1.1 (A:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleikrt
Timeline for d1rz8a1: