Lineage for d1rz7l2 (1rz7 L:108-213)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) 
Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
Domain d1rz7l2: 1rz7 L:108-213 [98136]
Other proteins in same PDB: d1rz7h1, d1rz7h2, d1rz7l1
part of anti HIV-1 gp120-reactive Fab 48D
complexed with gol
Details for d1rz7l2
PDB Entry: 1rz7 (more details), 2 Å
PDB Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 48d
PDB Compounds: (L:) Fab 48d light chainSCOPe Domain Sequences for d1rz7l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rz7l2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhklyacevthqglsspvtksfnrge
SCOPe Domain Coordinates for d1rz7l2:
Click to download the PDB-style file with coordinates for d1rz7l2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rz7l2:
- d1rz7l2 first appeared in SCOP 1.67
- d1rz7l2 appears in SCOPe 2.04
- d1rz7l2 appears in SCOPe 2.06
- d1rz7l2 appears in the current release, SCOPe 2.08
View in 3D
