Lineage for d1ryua_ (1ryu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692925Superfamily a.4.3: ARID-like [46774] (2 families) (S)
    contains extra helices at both N- and C-termini
  5. 2692926Family a.4.3.1: ARID domain [46775] (5 proteins)
  6. 2692935Protein SWI-SNF complex protein p270, SMARCF1 [109662] (1 species)
  7. 2692936Species Human (Homo sapiens) [TaxId:9606] [109663] (1 PDB entry)
    Uniprot O14497 617-736
  8. 2692937Domain d1ryua_: 1ryu A: [105127]

Details for d1ryua_

PDB Entry: 1ryu (more details)

PDB Description: solution structure of the swi1 arid
PDB Compounds: (A:) SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1

SCOPe Domain Sequences for d1ryua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryua_ a.4.3.1 (A:) SWI-SNF complex protein p270, SMARCF1 {Human (Homo sapiens) [TaxId: 9606]}
sstttnekitklyelggeperkmwvdrylafteekamgmtnlpavgrkpldlyrlyvsvk
eiggltqvnknkkwrelatnlnvgtsssaasslkkqyiqclyafeckiergedpppdifa

SCOPe Domain Coordinates for d1ryua_:

Click to download the PDB-style file with coordinates for d1ryua_.
(The format of our PDB-style files is described here.)

Timeline for d1ryua_: