Lineage for d1ryhb_ (1ryh B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Rac [52595] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52596] (19 PDB entries) 
Domain d1ryhb_: 1ryh B: [98103]
alternative splicing variant of rac1
complexed with gnp, mg
Details for d1ryhb_
PDB Entry: 1ryh (more details), 1.75 Å
PDB Description: Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase
PDB Compounds: (B:) ras-related C3 botulinum toxin substrate 1 isoform Rac1bSCOPe Domain Sequences for d1ryhb_:
Sequence, based on SEQRES records: (download)
>d1ryhb_ c.37.1.8 (B:) Rac {Human (Homo sapiens) [TaxId: 9606]}
gsmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
agqedydrlrplsypqtvgetygkditsrgkdkpiadvflicfslvspasfenvrakwyp
evrhhcpntpiilvgtkldlrddkdtieklkekkltpitypqglamakeigavkylecsa
ltqrglktvfdeairavlcpp
Sequence, based on observed residues (ATOM records): (download)
>d1ryhb_ c.37.1.8 (B:) Rac {Human (Homo sapiens) [TaxId: 9606]}
gsmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
iadvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrddkdtieklkekk
ltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
SCOPe Domain Coordinates for d1ryhb_:
Click to download the PDB-style file with coordinates for d1ryhb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ryhb_:
- d1ryhb_ first appeared in SCOP 1.67
- d1ryhb_ appears in SCOPe 2.05
- d1ryhb_ appears in SCOPe 2.07
- d1ryhb_ appears in the current release, SCOPe 2.08
View in 3D
