Lineage for d1rwsa_ (1rws A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179103Superfamily d.15.3: MoaD/ThiS [54285] (5 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 2179122Family d.15.3.2: ThiS [54289] (5 proteins)
  6. 2179126Protein Hypothetical protein PF1061 [102796] (1 species)
  7. 2179127Species Pyrococcus furiosus [TaxId:2261] [102797] (3 PDB entries)
  8. 2179129Domain d1rwsa_: 1rws A: [97991]
    structural genomics; low-resolution NMR structure

Details for d1rwsa_

PDB Entry: 1rws (more details)

PDB Description: Backbone Solution Structure of mixed alpha/beta protein PF1061
PDB Compounds: (A:) hypothetical protein PF1061

SCOPe Domain Sequences for d1rwsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwsa_ d.15.3.2 (A:) Hypothetical protein PF1061 {Pyrococcus furiosus [TaxId: 2261]}
kmikvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvleddevkdgdfve
vipvvsgg

SCOPe Domain Coordinates for d1rwsa_:

Click to download the PDB-style file with coordinates for d1rwsa_.
(The format of our PDB-style files is described here.)

Timeline for d1rwsa_: