Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.3: MoaD/ThiS [54285] (5 families) possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
Family d.15.3.2: ThiS [54289] (5 proteins) |
Protein Hypothetical protein PF1061 [102796] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [102797] (3 PDB entries) |
Domain d1rwsa_: 1rws A: [97991] structural genomics; low-resolution NMR structure |
PDB Entry: 1rws (more details)
SCOPe Domain Sequences for d1rwsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rwsa_ d.15.3.2 (A:) Hypothetical protein PF1061 {Pyrococcus furiosus [TaxId: 2261]} kmikvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvleddevkdgdfve vipvvsgg
Timeline for d1rwsa_: