| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins) |
| Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species) contains three heme groups; deletion of one of Cyt c3 heme-binding sites |
| Species Geobacter sulfurreducens, GSU1996 [TaxId:35554] [110039] (1 PDB entry) Uniprot Q74BP5 |
| Domain d1rwja_: 1rwj A: [105114] complexed with hem |
PDB Entry: 1rwj (more details), 1.7 Å
SCOP Domain Sequences for d1rwja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rwja_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Geobacter sulfurreducens, GSU1996 [TaxId: 35554]}
kgmtppktvnfkmkgvadaafshefhlgmykcnechtklfaykagakrftmadmdkgksc
gachngkdafssasdcgkchp
Timeline for d1rwja_: