Lineage for d1rv1a_ (1rv1 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735235Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1735236Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1735237Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 1735244Protein MDM2 [47594] (2 species)
  7. 1735262Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries)
  8. 1735331Domain d1rv1a_: 1rv1 A: [97901]
    complexed with imz

Details for d1rv1a_

PDB Entry: 1rv1 (more details), 2.3 Å

PDB Description: crystal structure of human mdm2 with an imidazoline inhibitor
PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d1rv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv1a_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

SCOPe Domain Coordinates for d1rv1a_:

Click to download the PDB-style file with coordinates for d1rv1a_.
(The format of our PDB-style files is described here.)

Timeline for d1rv1a_: