| Class g: Small proteins [56992] (90 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) ![]() |
| Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
| Protein LIM only 4 (Lmo4) [90205] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [90206] (2 PDB entries) Uniprot P61969 19-152 |
| Domain d1rutx2: 1rut X:49-82 [111940] fusion protein with the LIM domain-binding protein 1 region (Uniprot P70662 300-327) |
PDB Entry: 1rut (more details), 1.3 Å
SCOP Domain Sequences for d1rutx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]}
kcsscqaqlgdigtssytksgmilcrndyirlfg
Timeline for d1rutx2: