Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (2 species) has different dimerisation mode |
Species Human (Homo sapiens) [TaxId:9606] [54133] (19 PDB entries) Uniprot P13501 25-91 |
Domain d1rtoa_: 1rto A: [37416] |
PDB Entry: 1rto (more details)
SCOPe Domain Sequences for d1rtoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtoa_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]} spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre yinslems
Timeline for d1rtoa_: