Lineage for d1rtoa_ (1rto A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies)
beta(3)-alpha
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) 
form dimers with different dimerisation modesFamily d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) 
Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (2 species)
has different dimerisation modeSpecies Human (Homo sapiens) [TaxId:9606] [54133] (19 PDB entries)
Uniprot P13501 25-91
Domain d1rtoa_: 1rto A: [37416]
Details for d1rtoa_
PDB Entry: 1rto (more details)
PDB Description: proton nmr assignments and solution conformation of rantes, a chemokine of the cc type
PDB Compounds: (A:) rantesSCOPe Domain Sequences for d1rtoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtoa_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
yinslems
SCOPe Domain Coordinates for d1rtoa_:
Click to download the PDB-style file with coordinates for d1rtoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rtoa_:
- d1rtoa_ first appeared (with stable ids) in SCOP 1.55
- d1rtoa_ appears in SCOPe 2.07
View in 3D
