Lineage for d1rr9e_ (1rr9 E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1402024Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
    contains extra C-terminal alpha/beta subdomain
    automatically mapped to Pfam PF05362
  6. 1402025Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species)
  7. 1402026Species Escherichia coli [TaxId:562] [102771] (2 PDB entries)
  8. 1402037Domain d1rr9e_: 1rr9 E: [97787]
    complexed with so4

Details for d1rr9e_

PDB Entry: 1rr9 (more details), 2.1 Å

PDB Description: catalytic domain of e.coli lon protease
PDB Compounds: (E:) ATP-dependent protease La

SCOPe Domain Sequences for d1rr9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rr9e_ d.14.1.10 (E:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]}
rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
epsgmqvvtak

SCOPe Domain Coordinates for d1rr9e_:

Click to download the PDB-style file with coordinates for d1rr9e_.
(The format of our PDB-style files is described here.)

Timeline for d1rr9e_: