Lineage for d1rqwa_ (1rqw A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. Protein Thaumatin [49876] (1 species)
  7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (112 PDB entries)
    Uniprot P02883
  8. Domain d1rqwa_: 1rqw A: [97781]
    complexed with tla

Details for d1rqwa_

PDB Entry: 1rqw (more details), 1.05 Å

PDB Description: thaumatin structure at 1.05 a resolution
PDB Compounds: (A:) thaumatin I

SCOPe Domain Sequences for d1rqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqwa_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d1rqwa_ are not available.

Timeline for d1rqwa_: