Lineage for d1rqqa_ (1rqq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981797Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2981798Species Human (Homo sapiens) [TaxId:9606] [56163] (18 PDB entries)
  8. 2981814Domain d1rqqa_: 1rqq A: [97760]
    Other proteins in same PDB: d1rqqc_, d1rqqd_
    complexed with adaptor protein Aps
    complexed with 112, mn

Details for d1rqqa_

PDB Entry: 1rqq (more details), 2.6 Å

PDB Description: crystal structure of the insulin receptor kinase in complex with the sh2 domain of aps
PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d1rqqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqqa_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

SCOPe Domain Coordinates for d1rqqa_:

Click to download the PDB-style file with coordinates for d1rqqa_.
(The format of our PDB-style files is described here.)

Timeline for d1rqqa_: