Lineage for d1rqja_ (1rqj A:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.128: Terpenoid synthases [48575] (1 superfamily)
multihelical; core: 8 helices (C-J) are arranged in 2 parallel layersSuperfamily a.128.1: Terpenoid synthases [48576] (6 families) 
duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins) 
Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species) Species Escherichia coli [TaxId:562] [101453] (2 PDB entries) 
Domain d1rqja_: 1rqj A: [97744]
complexed with ipe, mg, ris
Details for d1rqja_
PDB Entry: 1rqj (more details), 1.95 Å
PDB Description: active conformation of farnesyl pyrophosphate synthase bound to isopentyl pyrophosphate and risedronate
PDB Compounds: (A:) GeranyltranstransferaseSCOPe Domain Sequences for d1rqja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqja_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]}
mdfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfg
vstntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtl
afsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrh
ktgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqg
adqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk
SCOPe Domain Coordinates for d1rqja_:
Click to download the PDB-style file with coordinates for d1rqja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rqja_:
- d1rqja_ first appeared in SCOP 1.67
- d1rqja_ appears in SCOPe 2.05
- d1rqja_ appears in SCOPe 2.07
- d1rqja_ appears in the current release, SCOPe 2.08
View in 3D
