Lineage for d1rpyb_ (1rpy B:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.93: SH2-like [55549] (1 superfamily)
3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helicesSuperfamily d.93.1: SH2 domain [55550] (2 families) 
Family d.93.1.1: SH2 domain [55551] (35 proteins)
Pfam PF00017
Protein Adaptor protein Aps [103139] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [103140] (2 PDB entries) 
Domain d1rpyb_: 1rpy B: [97719]
complexed with so4
Details for d1rpyb_
PDB Entry: 1rpy (more details), 2.3 Å
PDB Description: crystal structure of the dimeric sh2 domain of aps
PDB Compounds: (B:) adaptor protein APSSCOPe Domain Sequences for d1rpyb_:
Sequence, based on SEQRES records: (download)
>d1rpyb_ d.93.1.1 (B:) Adaptor protein Aps {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrlsl
nghgqchvqhlwfqsvfdmlrhfhthpipl
Sequence, based on observed residues (ATOM records): (download)
>d1rpyb_ d.93.1.1 (B:) Adaptor protein Aps {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrlsg
qchvqhlwfqsvfdmlrhfhthpipl
SCOPe Domain Coordinates for d1rpyb_:
Click to download the PDB-style file with coordinates for d1rpyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rpyb_:
- d1rpyb_ first appeared in SCOP 1.67
- d1rpyb_ appears in SCOPe 2.02
- d1rpyb_ appears in SCOPe 2.04
- d1rpyb_ appears in the current release, SCOPe 2.08
View in 3D
