Lineage for d1rpra_ (1rpr A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995434Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1995435Superfamily a.30.1: ROP protein [47380] (1 family) (S)
    automatically mapped to Pfam PF01815
  5. 1995436Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 1995437Protein ROP protein [47382] (1 species)
  7. 1995438Species Escherichia coli [TaxId:562] [47383] (17 PDB entries)
    Uniprot P03051
  8. 1995459Domain d1rpra_: 1rpr A: [16989]

Details for d1rpra_

PDB Entry: 1rpr (more details)

PDB Description: the structure of cole1 rop in solution
PDB Compounds: (A:) rop

SCOPe Domain Sequences for d1rpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpra_ a.30.1.1 (A:) ROP protein {Escherichia coli [TaxId: 562]}
mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclarfgddg
enl

SCOPe Domain Coordinates for d1rpra_:

Click to download the PDB-style file with coordinates for d1rpra_.
(The format of our PDB-style files is described here.)

Timeline for d1rpra_:

1995459
d1rpra_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1rprb_