Lineage for d1rp1a1 (1rp1 A:337-449)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
sandwich; 8 strands in 2 sheets; complex topology
duplication: has weak internal pseudo twofold symmetrySuperfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) 
Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
automatically mapped to Pfam PF01477Protein Pancreatic lipase, C-terminal domain [49731] (6 species) 
Species Dog (Canis familiaris) [TaxId:9615] [49736] (1 PDB entry)
pancreatic lipase related protein 1
Domain d1rp1a1: 1rp1 A:337-449 [23646]
Other proteins in same PDB: d1rp1a2
complexed with ca, nag
Details for d1rp1a1
PDB Entry: 1rp1 (more details), 2.1 Å
PDB Description: dog pancreatic lipase related protein 1
PDB Compounds: (A:) pancreatic lipase related protein 1SCOPe Domain Sequences for d1rp1a1:
Sequence, based on SEQRES records: (download)
>d1rp1a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Dog (Canis familiaris) [TaxId: 9615]}
rwrygvsitlsgkratgqakvalfgskgnthqfnifkgilkpgsthsnefdakldvgtie
kvkflwnnnvvnptfpkvgaakitvqkgeektvhsfcsestvredvlltltpc
Sequence, based on observed residues (ATOM records): (download)
>d1rp1a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Dog (Canis familiaris) [TaxId: 9615]}
rwrygvsitlsgkratgqakvalfgskgnthqfnifkgilkpgsthsnefdakldvgtie
kvkflwnnnnptfpkvgaakitvqkgeektvhsfcsestvredvlltltpc
SCOPe Domain Coordinates for d1rp1a1:
Click to download the PDB-style file with coordinates for d1rp1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rp1a1:
- d1rp1a1 first appeared (with stable ids) in SCOP 1.55, called d1rp1_1
- d1rp1a1 appears in SCOPe 2.05
- d1rp1a1 appears in SCOPe 2.07
- d1rp1a1 appears in the current release, SCOPe 2.08
View in 3D
