Lineage for d1ro7a_ (1ro7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923031Fold c.130: Alpha-2,3/8-sialyltransferase CstII [102413] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 8 strands, order 54321678
  4. 2923032Superfamily c.130.1: Alpha-2,3/8-sialyltransferase CstII [102414] (2 families) (S)
  5. 2923033Family c.130.1.1: Alpha-2,3/8-sialyltransferase CstII [102415] (2 proteins)
    automatically mapped to Pfam PF06002
  6. 2923034Protein Alpha-2,3/8-sialyltransferase CstII [102416] (1 species)
  7. 2923035Species Campylobacter jejuni [TaxId:197] [102417] (5 PDB entries)
  8. 2923042Domain d1ro7a_: 1ro7 A: [97667]
    complexed with csf, mpd

Details for d1ro7a_

PDB Entry: 1ro7 (more details), 1.8 Å

PDB Description: structural analysis of the sialyltransferase cstii from campylobacter jejuni in complex with a substrate analogue, cmp-3fneuac.
PDB Compounds: (A:) Alpha-2,3/8-sialyltransferase

SCOPe Domain Sequences for d1ro7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ro7a_ c.130.1.1 (A:) Alpha-2,3/8-sialyltransferase CstII {Campylobacter jejuni [TaxId: 197]}
mkkviiagngpslkeidysrlpndfdvfrcnqfyfedkyylgkkckavfynpslffeqyy
tlkhliqnqeyetelimcsnynqahlenenfvktfydyfpdahlgydffkqlkdfnayfk
fheiyfnqritsgvymcavaialgykeiylsgidfyqngssyafdtkqknllklapnfkn
dnshyighskntdikaleflektykiklyclcpnsllanfielapnlnsnfiiqeknnyt
kdilipsseaygkfskni

SCOPe Domain Coordinates for d1ro7a_:

Click to download the PDB-style file with coordinates for d1ro7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ro7a_: