Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species) |
Species Escherichia coli [TaxId:562] [51286] (10 PDB entries) Uniprot P06968 |
Domain d1rnja_: 1rnj A: [105021] complexed with dup, mg, trs; mutant |
PDB Entry: 1rnj (more details), 1.7 Å
SCOPe Domain Sequences for d1rnja_:
Sequence, based on SEQRES records: (download)
>d1rnja_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]} mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia dpslaammlprsglghkhgivlgnlvglinsdyqgqlmisvwnrgqdsftiqpgeriaqm ifvpvvqaefnlvedfdatdrgeggfghsgrq
>d1rnja_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]} mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia dpslaammlprsglghkhgivlgnlvglinsdyqgqlmisvwnrgqdsftiqpgeriaqm ifvpvvqaefnlvedfrfrq
Timeline for d1rnja_: