Lineage for d1rnja_ (1rnj A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427418Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2427488Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2427492Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
    Uniprot P06968
  8. 2427494Domain d1rnja_: 1rnj A: [105021]
    complexed with dup, mg, trs; mutant

Details for d1rnja_

PDB Entry: 1rnj (more details), 1.7 Å

PDB Description: crystal structure of inactive mutant dutpase complexed with substrate analogue imido-dutp
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1rnja_:

Sequence, based on SEQRES records: (download)

>d1rnja_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglinsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdatdrgeggfghsgrq

Sequence, based on observed residues (ATOM records): (download)

>d1rnja_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglinsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfrfrq

SCOPe Domain Coordinates for d1rnja_:

Click to download the PDB-style file with coordinates for d1rnja_.
(The format of our PDB-style files is described here.)

Timeline for d1rnja_: