Lineage for d1rn1a_ (1rn1 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170736Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2170737Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2170979Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)
  6. 2170990Protein RNase T1 [53939] (2 species)
  7. 2170993Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)
  8. 2171010Domain d1rn1a_: 1rn1 A: [36122]
    complexed with so4

Details for d1rn1a_

PDB Entry: 1rn1 (more details), 1.84 Å

PDB Description: three-dimensional structure of gln 25-ribonuclease t1 at 1.84 angstroms resolution: structural variations at the base recognition and catalytic sites
PDB Compounds: (A:) ribonuclease t1 isozyme

SCOPe Domain Sequences for d1rn1a_:

Sequence, based on SEQRES records: (download)

>d1rn1a_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyqlhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Sequence, based on observed residues (ATOM records): (download)

>d1rn1a_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyqlhedgetvgsnsyphkynnegfdfsvsspyyewpi
lssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

SCOPe Domain Coordinates for d1rn1a_:

Click to download the PDB-style file with coordinates for d1rn1a_.
(The format of our PDB-style files is described here.)

Timeline for d1rn1a_: