Lineage for d1rlua1 (1rlu A:8-205)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361112Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1361113Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1361114Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1361115Protein Cell-division protein FtsZ [52492] (9 species)
  7. 1361146Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries)
    Uniprot O08378
  8. 1361149Domain d1rlua1: 1rlu A:8-205 [104984]
    Other proteins in same PDB: d1rlua2, d1rlub2
    complexed with gol, gsp

Details for d1rlua1

PDB Entry: 1rlu (more details), 2.08 Å

PDB Description: mycobacterium tuberculosis ftsz in complex with gtp-gamma-s
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d1rlua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlua1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin

SCOPe Domain Coordinates for d1rlua1:

Click to download the PDB-style file with coordinates for d1rlua1.
(The format of our PDB-style files is described here.)

Timeline for d1rlua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rlua2