Lineage for d1rl6a2 (1rl6 A:82-170)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734251Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 734252Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 734253Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 734254Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 734336Species Bacillus stearothermophilus [TaxId:1422] [56056] (5 PDB entries)
  8. 734338Domain d1rl6a2: 1rl6 A:82-170 [41474]

Details for d1rl6a2

PDB Entry: 1rl6 (more details), 2 Å

PDB Description: ribosomal protein l6
PDB Compounds: (A:) protein (ribosomal protein l6)

SCOP Domain Sequences for d1rl6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rl6a2 d.141.1.1 (A:82-170) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]}
yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg
elaaniravrppepykgkgiryegelvrl

SCOP Domain Coordinates for d1rl6a2:

Click to download the PDB-style file with coordinates for d1rl6a2.
(The format of our PDB-style files is described here.)

Timeline for d1rl6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rl6a1