Lineage for d1rl1a_ (1rl1 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529991Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1529992Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 1530072Family b.15.1.3: GS domain [101580] (2 proteins)
    Pfam PF04969
  6. 1530073Protein Suppressor of G2 allele of skp1 homolog, gst1 [101581] (1 species)
  7. 1530074Species Human (Homo sapiens) [TaxId:9606] [101582] (1 PDB entry)
  8. 1530075Domain d1rl1a_: 1rl1 A: [97635]

Details for d1rl1a_

PDB Entry: 1rl1 (more details)

PDB Description: solution structure of human sgt1 cs domain
PDB Compounds: (A:) Suppressor of G2 allele of SKP1 homolog

SCOPe Domain Sequences for d1rl1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]}
skikydwyqtesqvvitlmiknvqkndvnvefsekelsalvklpsgedynlklellhpii
peqstfkvlstkieiklkkpeavrweklegqg

SCOPe Domain Coordinates for d1rl1a_:

Click to download the PDB-style file with coordinates for d1rl1a_.
(The format of our PDB-style files is described here.)

Timeline for d1rl1a_: