Lineage for d1rkqa_ (1rkq A:)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
contains an alpha+beta subdomain inserted into a new site after strand 3
Protein Hypothetical protein YidA [102315] (1 species) Species Escherichia coli [TaxId:562] [102316] (1 PDB entry) 
Domain d1rkqa_: 1rkq A: [97621]
structural genomics; NYSGRC target T1436
complexed with cl, mg
Details for d1rkqa_
PDB Entry: 1rkq (more details), 1.4 Å
PDB Description: crystal structure of had-like phosphatase yida from e. coli
PDB Compounds: (A:) Hypothetical protein yidASCOPe Domain Sequences for d1rkqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]}
slaikliaidmdgtlllpdhtispavknaiaaarargvnvvlttgrpyagvhnylkelhm
eqpgdycityngalvqkaadgstvaqtalsyddyrfleklsrevgshfhaldrttlytan
rdisyytvhesfvatiplvfceaekmdpntqflkvmmidepaildqaiaripqevkekyt
vlksapyfleildkrvnkgtgvksladvlgikpeeimaigdqendiamieyagvgvavdn
aipsvkevanfvtksnledgvafaiekyvln
SCOPe Domain Coordinates for d1rkqa_:
Click to download the PDB-style file with coordinates for d1rkqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rkqa_:
- d1rkqa_ first appeared in SCOP 1.67
- d1rkqa_ appears in SCOP 1.75
- d1rkqa_ appears in SCOPe 2.02
- d1rkqa_ appears in the current release, SCOPe 2.08, called d1rkqa1
View in 3D
